PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10012881
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family bZIP
Protein Properties Length: 371aa    MW: 40688.2 Da    PI: 6.513
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10012881genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_129.81.3e-09154201552
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 
                  kr++r + NR +A rs +RK  +i eLe+kv++L+ae  +L  +l   
  Lus10012881 154 KRAKRIIANRQSAARSKERKARYILELERKVQNLQAEAATLGAQLTLF 201
                  9*************************************9998877665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.3E-15150214IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.151152215IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.13E-9154209No hitNo description
PfamPF001701.1E-7154198IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.3E-9154206No hitNo description
CDDcd147031.32E-23155204No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
MQDDTNPNPN TTASPNANGG DSQTPRGSFH RRAFSEFEFR IPDDLDLDPL DAPSVTSFDE  60
LGSEDDLFYT YMDMEGGSLG SKPDDIDQKI AGKVGIDDAA ANPSLSGGVG GNTGAKGKHR  120
HSNSVDGSSF VQSVEAKKAM GPDKLAELWN MDPKRAKRII ANRQSAARSK ERKARYILEL  180
ERKVQNLQAE AATLGAQLTL FQRDTLGLTN ENANLKLRVQ AMEQQAQLRE AVNDALKKEV  240
EMLKIAMGER TAQQQLEYPY NMGMHHQHHH LSYNHPPFFP LHQQQPGNIM YNPHSIQVPQ  300
FHPFQPNNNL PNSCHLPTVA AALPNHHGRG FPEMLPHERL QGLDISGGGG RSYVVVKSEG  360
PSISASESSN *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007011316.11e-117Basic-leucine zipper transcription factor family protein isoform 2
SwissprotQ6S4P42e-83RF2B_ORYSJ; Transcription factor RF2b
TrEMBLA0A061FSP51e-117A0A061FSP5_THECC; Basic-leucine zipper transcription factor family protein isoform 2
STRINGVIT_13s0067g02900.t011e-113(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15483497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40620.12e-84bZIP family protein